PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000575835
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 657aa    MW: 73713.2 Da    PI: 5.7105
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000575835genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM124.87.1e-39181461128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                    lp+G+rFhPt+eel+++yLk k++gk+  ++++i+e++i+++eP++Lp  ++ ++++ewyf+ +   k+++ ++ +rat++g+Wk+tgk+k v+++
  MDP0000575835  18 LPVGYRFHPTEEELISHYLKLKLRGKDSLVSDAIREINICNYEPRELPeISLIKSDDEWYFYNRPIYKKNSRNEVERATATGFWKSTGKEKIVKAR 113
                    799************************99999****************545556789*************************************** PP

            NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                    +++ +g k++L+f +gr +++  t+Wvmhe+++
  MDP0000575835 114 DNKIIGKKRILTFRQGRGRNAPITNWVMHEFSI 146
                    *******************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.5E-429166IPR003441NAC domain
PROSITE profilePS5100543.41718166IPR003441NAC domain
PfamPF023652.8E-2019146IPR003441NAC domain
Gene3DG3DSA:1.10.238.107.9E-5514583IPR011992EF-hand domain pair
SuperFamilySSF474739.07E-6522584IPR011992EF-hand domain pair
PROSITE patternPS000180568580IPR018247EF-Hand 1, calcium-binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 657 aa     Download sequence    Send to blast
MASNGIRFTR VEVEGLLLPV GYRFHPTEEE LISHYLKLKL RGKDSLVSDA IREINICNYE  60
PRELPEISLI KSDDEWYFYN RPIYKKNSRN EVERATATGF WKSTGKEKIV KARDNKIIGK  120
KRILTFRQGR GRNAPITNWV MHEFSIPQIX PNANQRDFVL CYVKKKSGKN TDVATGDEGE  180
SSNYNNAXDF ENQLQPAXNM HVEEERTQPP PNPDIFQREL DXMLGNTRGN NDYHGMDENL  240
EEFVNGLFGD DPYQGYSEEI THNNVFNDST LPQSPRKVYL XDCGVSSDSD TEVQHQAAQG  300
PSLQMLGVPQ ASSSHFGREE GXMLRNQTLX QAASSINVLP KPQTDRLQSI SDEDSGTHQI  360
TSRLRRASRP INALKLKSAS SVDVDAVSLQ INSIQLASDE YYNSERTRRR TYPTSALLAL  420
GKPNELEQQQ SKAKVAAERR AAVDFPPKRN FITESNKDAE AVQGNNTEKG LKQTHNATTA  480
GNWMSCSCIS GETSPPLTGP PSVYLFNTRQ LRKASMAEND AFAFLKGDSH GDFITSSAFC  540
EALQQVNLIG HPAGLGFQET RDLWIQADAD ANGVLDYEEF KNRIWSSTAS EDKESLNGSR  600
EESKRGMQDS LGFNVKNAVL YPPEAEKGIW PEDYTLSDHA RLSVVLSPER MWCCKS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-211616615165NO APICAL MERISTEM PROTEIN
1ut4_B3e-211616615165NO APICAL MERISTEM PROTEIN
1ut7_A3e-211616615165NO APICAL MERISTEM PROTEIN
1ut7_B3e-211616615165NO APICAL MERISTEM PROTEIN
4dul_A3e-211616615165NAC domain-containing protein 19
4dul_B3e-211616615165NAC domain-containing protein 19
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.244490.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008347199.10.0PREDICTED: NAC domain-containing protein 19-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13478522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01550.13e-35NAC domain containing protein 69